Sequence Information

Species：Mouse Gene ID:21803

Swiss Prot:P04202 Synonyms:TGF-B1; CED; DPD1; LAP; Camurati-Engelmann

Disease; Latency-associated peptide

Residues:Ala279-Ser390

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGR

KPKVEQLSNMIVRSCKCS

Product Information

Source: Prokaryotic expression. Host: E. coli

Tags:N-terminal His Tag

Subcellular Location: Secreted， Extracellular matrix. Purity: >97%

Traits: Freeze-dried powder

Buffer formulation:PBS， pH7.4， containing 0.1% SKL， 5% Trehalose. Original Concentration: 150µg/mL

Applications: Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.)

Predicted isoelectric point: 8.4

Predicted Molecular Mass: 14.3kDa

Accurate Molecular Mass: 16kDa as determined by SDS-PAGE reducing conditions. [ USAGE ]

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex. [ STORAGE AND STABILITY ]

Storage: Avoid repeated freeze/thaw cycles. Store at 2-8

oC for one month. Aliquot and store at -80

oC for 12 months. Stability Test: The thermal stability is described by the loss rate. The loss rate was determined by

accelerated thermal degradation test， that is， incubate the protein at 37

oC for 48h， and no obvious

degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under

appropriate storage condition. [ IDENTIFICATION ]Figure 1. Gene Sequencing (Extract)

Figure 2. SDS-PAGE

[ IMPORTANT NOTE ]

The kit is designed for in vitro and research use only， we will not be responsible for any issue if the kit was

used in clinical diagnostic or any other procedures.